General Information

  • ID:  hor002504
  • Uniprot ID:  A0A8S3Q0F9??909-912)
  • Protein name:  APGWamide
  • Gene name:  NA
  • Organism:  Mytilus edulis (Blue mussel)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mytilus (genus), Mytilinae (subfamily), Mytilidae (family), Mytiloidea (superfamily), Mytilida (order), Pteriomorphia, Autobranchia (subclass), Bivalvia (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005044 scavenger receptor activity; GO:0005509 calcium ion binding
  • GO BP:  GO:0006897 endocytosis
  • GO CC:  GO:0005886 plasma membrane

Sequence Information

  • Sequence:  APGW
  • Length:  4(909-912)
  • Propeptide:  MDNLISLSWILIFFSCNWDLVPAPNYEQYRLRPGMPNVCPYQDVQMILVRVPCVQRYTRMVKVWKPNCGGTKKWCIGHERRTHYYKTTRQRYQHQYVTRYKCCHGWQEVNGLGCMFRQCDPNSCYNGGTCYGGYDQRCRCTPNFEGTRCQHDVDECRANNGNCEHKCFNSIGSFYCGCHEGFQLAEDDKRCVDIDECSTKNGGCQHRCQNSHGGFICLCPDGYRLHADGRTCIAVSGCTRNQGGCDHICVDSYNG
  • Signal peptide:  MDNLISLSWILIFFSCNWDLVPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002504_AF2.pdbhor002504_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 48317 Formula: C21H27N5O5
Absent amino acids: CDEFHIKLMNQRSTVY Common amino acids: AGPW
pI: 6.11 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -27.5 Boman Index: 508
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 25
Instability Index: 8650 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1833.33

Literature

  • PubMed ID:  8852595
  • Title:  Molecular Cloning of a cDNA Encoding the Precursor of Ala-Pro-Gly-Trp Amide-Related Neuropeptides From the Bivalve Mollusc Mytilus Edulis